PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A02150.1.p
Common NameEUGRSUZ_A02150, LOC104443385
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 275aa    MW: 30581.3 Da    PI: 8.9175
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A02150.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65e-17109154147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg W + Ed +l+++v+++G+ +W++Ia+ ++ gR++k+c++rw++ 
  Eucgr.A02150.1.p 109 RGHWRPSEDAKLKELVAKYGPQNWNLIAENFQ-GRSGKSCRLRWFNQ 154
                       899*****************************.***********996 PP

2Myb_DNA-binding551.9e-17161204146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       r+++++eE+e+l+ a+k+ G++ W+ Iar ++ gRt++ +k++w+ 
  Eucgr.A02150.1.p 161 RKPFSEEEEERLLTAHKLCGNK-WAMIARLFP-GRTDNAVKNHWHV 204
                       789*******************.*********.***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.762104155IPR017930Myb domain
SMARTSM007176.2E-15108157IPR001005SANT/Myb domain
SuperFamilySSF466892.92E-29109202IPR009057Homeodomain-like
PfamPF002496.3E-17109154IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-27110162IPR009057Homeodomain-like
CDDcd001671.53E-13112153No hitNo description
PROSITE profilePS5129425.686156210IPR017930Myb domain
SMARTSM007176.3E-15160208IPR001005SANT/Myb domain
PfamPF002492.9E-14161203IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-20163209IPR009057Homeodomain-like
CDDcd001672.25E-11163203No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MSLQHVKTAF NHFTASQGIE FLLPPPQMVS LAVELESLRS RAAKRACGDG REGLVLKKGL  60
DLNVCEEEAE AEAEEETETE EQEQEEEGGA ATKGSGPGRN SGRTKVCARG HWRPSEDAKL  120
KELVAKYGPQ NWNLIAENFQ GRSGKSCRLR WFNQLDPRIN RKPFSEEEEE RLLTAHKLCG  180
NKWAMIARLF PGRTDNAVKN HWHVIVARKQ REQSNNARGR RRNHKLLPRP QTRGLNNIAS  240
AAKINRACSD STTVSSNLNE SAVSTCTDLS LTPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-341072095107B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1218225GRRRNHKL
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A02150.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010055057.10.0PREDICTED: transcription factor MYB44-like
TrEMBLA0A059DGT00.0A0A059DGT0_EUCGR; Uncharacterized protein
STRINGPOPTR_0019s05740.15e-77(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.14e-67myb domain protein 105